discontinued

NBP1-93836 C8orf58 antibody

See related secondary antibodies

Search for all "C8orf58"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C8orf58

Product Description for C8orf58

Rabbit anti Human C8orf58.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C8orf58

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NAV2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
GeneID:
541565
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 541565

Accessory Products

Proteins and/or Positive Controls

Proteins for C8orf58 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 8 open reading frame 58 (C8orf58)

Chromosome 8 open reading frame 58 (C8orf58) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C8orf58 (2 products)

Catalog No. Species Pres. Purity   Source  

C8orf58 overexpression lysate

C8orf58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C8orf58 overexpression lysate

C8orf58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn