H00138724-B01P C9orf131 antibody

See related secondary antibodies

Search for all "C9orf131"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf131

H00138724-B01P

Product Description for C9orf131

Mouse anti Human C9orf131.
Product is tested for Western blot / Immunoblot.

Properties for C9orf131

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ00273, MGC41945
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VYM1
Immunogen:
C9orf131 (AAH45643.1, 1 a.a. ~ 1065 a.a) full-length human protein.
AA Sequence:
MGLLWGQLTHALACRHCGSSCFQSPGNLVTLFLFVVWQIQRWWQLGRLRQLHPWCSGNMVQGKELPLLHRVAFLDH LCKQKSEVEEEGEEEEEGEDEASLDPLKPCSPTKEAPTGEQATPAPPQPSCGSEGLLKAIGIPEQTVMQPVSPSRS FPIFQILTSFPVRHKIASGNRQQQRKSQLFWGLPSLHSESLEAIFLSSGGPYPLKLSVCSSVFFNKLAFLPRSNLL LPQYHSSAQFSTHGAHTMEDLEGMAPDPQLLPPPSSPSVSSLLLHLRPFPVDHKGVLSGAEAPTQSPGTSPLEVLP GYETHLETTGHKKMPQAFEPPMPPPCQSPASLSEPRKVSPEGGLAISKDFWGTVGYREKPQASESSMPVPCPPLDS LPELQRESSLEDPSRYKPQWECRENSGNLWAFESPVLDLNPELSGTSPECVPPASETPWKGMQSRENIWVPADPVS PPSLPSVPLLESLVMGPQGVLSESKALWETMGQKENLWASDSPDPVHSTPPTTLMEPHRINPGECLATSEATWKDT EHSRNSSASRSPSLALSPPPALAPELLRVRSMGVLSDSEARCGDIQKTKNSWASKHPACNLPQDLHGASPLGVLSD SQSIVGEMEQKENCVPVFPGRGSSPSSNSVSKSHVSEPIADQSNYKPDGEAVEQRKNHWATELPAPSSLSTPLPEP HIDLELVWRNVQQREVPQGPSPLAVDPLHPVPQPPTLAEAVKIERTHPGLPKGVTCPGVKAEAPLSQRWTVPELLT HPGIHAWQWSRELKLRLKKLRQSPASRAPGPSQSFCSSPILSSTIPDFWGLPSCPPQQIYPPNPCPHSSSCHPQEV QRTVPQPVQSSHCHHFQSSSQLQPQESGRAEQGSQRGEKMKGKMVSQVPSQGPCVHMEAGVDYLSPGPGEPSNSKV LVSGKRKDKASASSSAKKREHPRKPKAGDHRRGTARLGLSTVTGKNHPAQARSLVEAPVSTFPQRSQHRGQSSQHT ALPQLLLPKASGPQDQPEAGRRASDILTPRHCKHCPWAHMEKYLSFPTLKASLTRGLQKVLAKCLDNHRPLPTKSS Q
GeneID:
138724
Add. information Mouse polyclonal antibody raised against a full-length human C9orf131 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn