NBP1-90685 C9orf135 antibody

See related secondary antibodies

Search for all "C9orf135"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C9orf135

Product Description for C9orf135

Rabbit anti Human C9orf135.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C9orf135

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VTT2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDSLDRSCQDWCDRKQHWLEIGPPDLVERKGSLTLRSHHKKYSKPVLVYSWHRDREAFPKGYDIEGPEKVK
GeneID:
138255
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 138255

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf135 (1 products)

Catalog No. Species Pres. Purity   Source  

C9orf135 overexpression lysate

C9orf135 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn