H00401563-B01P C9orf139 antibody

See related secondary antibodies

Search for all "C9orf139"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf139

H00401563-B01P

Product Description for C9orf139

Mouse anti Human C9orf139.
Product is tested for Western blot / Immunoblot.

Properties for C9orf139

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ36268, FLJ42909
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZV77
Immunogen:
C9orf139 (ADR83488.1, 1 a.a. ~ 190 a.a) full-length human protein.
AA Sequence:
MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLPRLRVTR PLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSCVGTCELANGARG FCPEMGQNESLSEEREGHESKRKSGGRGSPSSHPTQAS
GeneID:
401563
Add. information Mouse polyclonal antibody raised against a full-length human C9orf139 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf139 (1 products)

Catalog No. Species Pres. Purity   Source  

C9orf139 overexpression lysate

C9orf139 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn