H00085026-B01P C9orf37 antibody

See related secondary antibodies

Search for all "C9orf37"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf37

H00085026-B01P

Product Description for C9orf37

Mouse anti Human C9orf37.
Product is tested for Western blot / Immunoblot.

Properties for C9orf37

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2J1
Immunogen:
C9orf37 (NP_116326.2, 1 a.a. ~ 176 a.a) full-length human protein.
AA Sequence:
MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPL FLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLG KPLHAPAGFSAGEVHTTPLGNLGA
GeneID:
85026
Add. information Mouse polyclonal antibody raised against a full-length human C9orf37 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf37 (1 products)

Catalog No. Species Pres. Purity   Source  

C9orf37 Lysate

Western Blot: C9orf37 Lysate [NBL1-08594] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C9orf37
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn