NBP1-86012 C9orf37 antibody

See related secondary antibodies

Search for all "C9orf37"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C9orf37

NBP1-86012

More Views

  • NBP1-86012

Product Description for C9orf37

Rabbit anti Human C9orf37.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for C9orf37

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2J1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHH
GeneID:
85026
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 85026

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf37 (1 products)

Catalog No. Species Pres. Purity   Source  

C9orf37 Lysate

Western Blot: C9orf37 Lysate [NBL1-08594] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C9orf37
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn