H00157927-B01P C9orf62 antibody

See related secondary antibodies

Search for all "C9orf62"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf62

H00157927-B01P

Product Description for C9orf62

Mouse anti Human C9orf62.
Product is tested for Western blot / Immunoblot.

Properties for C9orf62

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC35463, RP11-555H7.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4C0
Immunogen:
C9orf62 (AAH34752.1, 1 a.a. ~ 152 a.a) full-length human protein.
AA Sequence:
MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGCSVDRTA GRPVLGWRLRNSLTGQEGRQHLHLSGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQWGWFLSSLFLKIF
GeneID:
157927
Add. information Mouse polyclonal antibody raised against a full-length human C9orf62 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn