H00138241-B01P C9orf85 antibody

See related secondary antibodies

Search for all "C9orf85"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf85

H00138241-B01P

Product Description for C9orf85

Mouse anti Human C9orf85.
Product is tested for Western blot / Immunoblot.

Properties for C9orf85

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC61599
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MD7
Immunogen:
C9orf85 (NP_872311.2, 1 a.a. ~ 157 a.a) full-length human protein.
AA Sequence:
MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQK TVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTENNLSSNHRRSCRRNEESDDDLDFDIDLEDTGG DHQMN
GeneID:
138241
Add. information Mouse polyclonal antibody raised against a full-length human C9orf85 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C9orf85 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 9 open reading frame 85 (C9orf85)

Chromosome 9 open reading frame 85 (C9orf85) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C9orf85 (2 products)

Catalog No. Species Pres. Purity   Source  

C9orf85 Lysate

Western Blot: C9orf85 Lysate [NBL1-08604] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C9orf85
0.1 mg / €400.00
  Novus Biologicals Inc.

C9orf85 overexpression lysate

C9orf85 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn