H00203197-B01P C9orf91 antibody

See related secondary antibodies

Search for all "C9orf91"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C9orf91

H00203197-B01P

Product Description for C9orf91

Mouse anti Human C9orf91.
Product is tested for Western blot / Immunoblot.

Properties for C9orf91

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp547P234, FLJ38045, MGC129868, MGC129869, RP11-402G3.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VZI3
Immunogen:
C9orf91 (NP_694590.2, 1 a.a. ~ 342 a.a) full-length human protein.
AA Sequence:
MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWGIQVPAD QYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLAAVSLTLTLVLVF ERHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSR LSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTS QLPQAMGTRHTNSPRIPCPCQLIEAYILGTGCCPFLAR
GeneID:
203197
Add. information Mouse polyclonal antibody raised against a full-length human C9orf91 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C9orf91 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 9 open reading frame 91 (C9orf91)

Chromosome 9 open reading frame 91 (C9orf91) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn