NBP1-68888 CA7 antibody

See related secondary antibodies

Search for all "CA7"

Quick Overview

Rabbit anti Human CA7

Product Description for CA7

Rabbit anti Human CA7.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CA7

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CAVII
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR.
Background Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 766

Accessory Products

  • LinkedIn