discontinued

H00000784-B01P CACNB3 antibody

See related secondary antibodies

Search for all "CACNB3"

Quick Overview

Mouse anti Human CACNB3

Product Description for CACNB3

Mouse anti Human CACNB3.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CACNB3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CAB3, CACNLB3, Calcium channel voltage-dependent subunit beta 3, Voltage-dependent L-type calcium channel subunit beta-3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P54284
Immunogen:
CACNB3 (NP_000716.2, 1 a.a. ~ 484 a.a) full-length human protein.
AA Sequence:
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGVLDE ECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGNPSSLSDIGNRRS PPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSV LNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLI RSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRATHHPAPGPGLLGPPSAIPGLQ NQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQ DRLLAQDSEHNHSDRNWQRNRPWPKDSY
GeneID:
784
Remarks:
Gene Accession: NM_000725
Add. information Mouse polyclonal antibody raised against a full-length human CACNB3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 784

Accessory Products

Proteins and/or Positive Controls

Proteins for CACNB3 (3 products)

Catalog No. Species Pres. Purity   Source  

CACNB3

CACNB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

CACNB3

CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB3

CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CACNB3 (1 products)

Catalog No. Species Pres. Purity   Source  

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn