TA338485 Cadherin-23 antibody

Rabbit Polyclonal Anti-CDH23 Antibody

See related secondary antibodies

Search for all "Cadherin-23"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-23

Product Description for Cadherin-23

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-23.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cadherin-23

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CDH23, KIAA1774, KIAA1812
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-CDH23 antibody: synthetic peptide directed towards the middle region of human CDH23. Synthetic peptide located within the following region: DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI.
Application WB
Background This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Cadherin-23 (3 products)

Catalog No. Species Pres. Purity   Source  

Cadherin-23 (transcript variant 2)

Cadherin-23 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


Cadherin-23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


Cadherin-23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cadherin-23 (1 products)

Catalog No. Species Pres. Purity   Source  

CDH23 overexpression lysate

CDH23 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn