NBP1-57086 cAMP Protein Kinase Catalytic subunit alpha antibody

See related secondary antibodies

Search for all "cAMP Protein Kinase Catalytic subunit alpha"

50 µg / €390.00

Quick Overview

Rabbit anti Human cAMP Protein Kinase Catalytic subunit alpha

Product Description for cAMP Protein Kinase Catalytic subunit alpha

Rabbit anti Human cAMP Protein Kinase Catalytic subunit alpha.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for cAMP Protein Kinase Catalytic subunit alpha

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha) The peptide sequence was selected from the N terminal of PRKACA. Peptide sequence MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV.
Background cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn