TA331742 CARS2 antibody

Rabbit Polyclonal Anti-CARS2 Antibody

See related secondary antibodies

Search for all "CARS2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CARS2

Product Description for CARS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CARS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CARS2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Probable cysteinyl-tRNA synthetase mitochondrial, cysteinyl-tRNA synthetase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-CARS2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARS2. Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW.
Application WB
Background The function of this protein remains unknown.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn