discontinued

H00000838-A01 Caspase-5 antibody

See related secondary antibodies

Search for all "Caspase-5"

Quick Overview

Mouse anti Human Caspase-5

Product Description for Caspase-5

Mouse anti Human Caspase-5.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Caspase-5

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms CASP-5, CASP5, ICE(rel)-III, ICH-3 protease, ICH3, TY protease
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51878
Immunogen:
CASP5 (NP_004338, 309 a.a. ~ 419 a.a) partial recombinant protein with GST tag.
AA Sequence:
VRDSPASLAVISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIF RKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN*
GeneID:
838
Remarks:
Gene Accession: NM_004347
Add. information Mouse polyclonal antibody raised against a partial recombinant CASP5.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 838

Accessory Products

Proteins and/or Positive Controls

Proteins for Caspase-5 (4 products)

Catalog No. Species Pres. Purity   Source  

Caspase-5 (full length, N-term HIS tag, transcript variant a)

Caspase-5 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Caspase-5

Caspase-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Caspase-5

Caspase-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Caspase-5

Caspase-5 Human
  Abnova Taiwan Corp.

Positive controls for Caspase-5 (3 products)

Catalog No. Species Pres. Purity   Source  

CASP5 overexpression lysate

CASP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CASP5 overexpression lysate

CASP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Caspase 5 Lysate

Western Blot: Caspase 5 Lysate [NBL1-08714] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CASP5.
  Novus Biologicals Inc.
  • LinkedIn