TA331883 CASZ1 antibody

Rabbit Polyclonal Anti-CASZ1 Antibody

See related secondary antibodies

Search for all "CASZ1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat CASZ1

Product Description for CASZ1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat CASZ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CASZ1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CST, Castor-related protein, Putative survival-related protein, SRG, ZNF693, Zinc finger protein 693, Zinc finger protein castor homolog 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86V15
Immunogen:
The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA.
GeneID:
54897
Application WB
Background CASZ1 contains 8 C2H2-type zinc fingers.It is expressed in a number of human tumors and localizes to a chromosomal region frequently lost in tumors of neuroectodermal origin.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CASZ1 (1 products)

Catalog No. Species Pres. Purity   Source  

CASZ1 Lysate

Western Blot: CASZ1 Lysate [NBL1-08724] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CASZ1
  Novus Biologicals Inc.
  • LinkedIn