TA330402 Caveolin-2 antibody

Rabbit Polyclonal Anti-CAV2 Antibody

See related secondary antibodies

Search for all "Caveolin-2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Caveolin-2


More Views

  • TA330402
  • TA330402

Product Description for Caveolin-2

Rabbit anti Human Caveolin-2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Caveolin-2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CAV2
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2. Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE.
Application IHC
Background CAV2 is a major component of the inner surface of caveolae, small invagitions of the plasma membrane, and is involved in essential cellular functions, including sigl transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using altertive initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invagitions of the plasma membrane, and is involved in essential cellular functions, including sigl transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using altertive initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Caveolin-2 (4 products)

Catalog No. Species Pres. Purity   Source  

Caveolin-2 (transcript variant 1)

Caveolin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Caveolin-2 (full length, N-term HIS tag, transcript variant 2)

Caveolin-2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.


Caveolin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


Caveolin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Caveolin-2 (3 products)

Catalog No. Species Pres. Purity   Source  

CAV2 overexpression lysate

CAV2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Caveolin 2 Lysate

Western Blot: Caveolin 2 Lysate [NBL1-08730] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CAV2
  Novus Biologicals Inc.

Caveolin 2 Lysate

Western Blot: Caveolin 2 Lysate [NBL1-08731] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CAV2
  Novus Biologicals Inc.
  • LinkedIn