discontinued

H00008535-B01 CBX4 / PC2 antibody

See related secondary antibodies

Search for all "CBX4 / PC2"

Quick Overview

Mouse anti Human CBX4 / PC2

Product Description for CBX4 / PC2

Mouse anti Human CBX4 / PC2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CBX4 / PC2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Chromobox protein homolog 4, E3 SUMO-protein ligase CBX4, Polycomb 2 homolog
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O00257
Immunogen:
CBX4 (AAH14967.1, 1 a.a. ~ 290 a.a) full-length human protein.
AA Sequence:
MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKP KPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHHHAVGLNLSHVRKRCLSETHGERE PCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETP ASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
GeneID:
8535
Remarks:
Gene Accession: BC014967.1
Add. information Mouse polyclonal antibody raised against a full-length human CBX4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 8535

Accessory Products

Proteins and/or Positive Controls

Proteins for CBX4 / PC2 (4 products)

Catalog No. Species Pres. Purity   Source  

CBX4 / PC2

CBX4 / PC2 Human Purified
  Abnova Taiwan Corp.

CBX4 / PC2

CBX4 / PC2 Human Purified
  Abnova Taiwan Corp.

CBX4 / PC2

CBX4 / PC2 Human
  Abnova Taiwan Corp.

CBX4 / PC2

CBX4 / PC2 Human
  Abnova Taiwan Corp.

Positive controls for CBX4 / PC2 (1 products)

Catalog No. Species Pres. Purity   Source  

CBX4 293T Cell Transient Overexpression Lysate(Denatured)

CBX4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn