NBP1-57482 CCBL2 antibody

See related secondary antibodies

Search for all "CCBL2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CCBL2

Product Description for CCBL2

Rabbit anti Human CCBL2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CCBL2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms RBM1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MY75
Immunogen:
Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
Background CCBL2 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn