H00055013-B01P CCDC109B antibody

See related secondary antibodies

Search for all "CCDC109B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CCDC109B

H00055013-B01P

Product Description for CCDC109B

Mouse anti Human CCDC109B.
Product is tested for Western blot / Immunoblot.

Properties for CCDC109B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ20647
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWR8
Immunogen:
CCDC109B (NP_060388.1, 1 a.a. ~ 248 a.a) full-length human protein.
AA Sequence:
MLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHM KSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAKESL KQARHSLCLQMQVEELNEKN
GeneID:
55013
Add. information Mouse polyclonal antibody raised against a full-length human CCDC109B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn