NBP1-93660 CCDC125 antibody

See related secondary antibodies

Search for all "CCDC125"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CCDC125

NBP1-93660

More Views

  • NBP1-93660
  • NBP1-93660

Product Description for CCDC125

Rabbit anti Human CCDC125.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for CCDC125

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86Z20
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLNQRYLEALAMLDIKQQKMAQENMCCDKSGFAEASGLELAVLGACLCHGPGGNPCSCARMAASTRKLLLQLKQELEILQKSKEEAYVMADAFRIAFE
GeneID:
202243
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 202243

Accessory Products

Proteins and/or Positive Controls

Positive controls for CCDC125 (1 products)

Catalog No. Species Pres. Purity   Source  

CCDC125 overexpression lysate

CCDC125 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn