H00284992-B01P CCDC150 antibody

See related secondary antibodies

Search for all "CCDC150"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CCDC150

H00284992-B01P

Product Description for CCDC150

Mouse anti Human CCDC150.
Product is tested for Western blot / Immunoblot.

Properties for CCDC150

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp434P055, FLJ10202, FLJ38811, FLJ39660, MGC72171
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCX0
Immunogen:
CCDC150 (AAH62449.1, 1 a.a. ~ 245 a.a) full-length human protein.
AA Sequence:
MLENVLASHSKMQGALEKVQIELGRRDSEIAGLKKERDLNQQRVQKLEAEVDQWQARMLVMEDQHNSEIESLQKAL GVAREDNRKLAMSLEQALQTNNHLQTKLDHIQEQLESKELERQNLETFKDRMTEESKVEAELHAERIEALRKQFQT ERETTKKVAQREVAELKKALDEANFRSVEVSRTNRELRQKLAELEKILESNKEKIKNQKTQIKLHLSAKANNAQNI ERMKVVWETSSHFLDTL
GeneID:
284992
Add. information Mouse polyclonal antibody raised against a full-length human CCDC150 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn