
NBP1-57843 CCDC19 antibody

See related secondary antibodies

Search for all "CCDC19"

Quick Overview

Rabbit anti Human CCDC19

Product Description for CCDC19

Rabbit anti Human CCDC19.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC19

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 25790

Accessory Products

  • LinkedIn