NBP1-57843 CCDC19 antibody

See related secondary antibodies

Search for all "CCDC19"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CCDC19

Product Description for CCDC19

Rabbit anti Human CCDC19.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC19

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 25790

Accessory Products

  • LinkedIn