NBP1-81071 CCDC23 antibody

See related secondary antibodies

Search for all "CCDC23"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CCDC23

NBP1-81071

More Views

  • NBP1-81071

Product Description for CCDC23

Rabbit anti Human CCDC23.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CCDC23

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N300
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
GeneID:
374969
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 374969

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC23 (3 products)

Catalog No. Species Pres. Purity   Source  

CCDC23 (1-66, His-tag)

CCDC23 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

CCDC23 (1-66, His-tag)

CCDC23 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Coiled-coil domain containing 23 (CCDC23)

Coiled-coil domain containing 23 (CCDC23) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for CCDC23 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC23 Lysate

Western Blot: CCDC23 Lysate [NBL1-08786] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCDC23
0.1 mg / €400.00
  Novus Biologicals Inc.

CCDC23 overexpression lysate

CCDC23 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn