H00149473-B01P CCDC24 antibody

See related secondary antibodies

Search for all "CCDC24"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CCDC24

H00149473-B01P

Product Description for CCDC24

Mouse anti Human CCDC24.
Product is tested for Western blot / Immunoblot.

Properties for CCDC24

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC45441, RP5-1198O20.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4L8
Immunogen:
CCDC24 (NP_689712.1, 1 a.a. ~ 307 a.a) full-length human protein.
AA Sequence:
MLRHSPSLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAPPPL LKDLLRQELRQLLQGLRHKAICEGRDQAQAWVQYSPRVLHFALEEPRCDLPEQEIFQMRGGGPSSGHRDLSIIKDQ LNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQELQASVGPSC VSPNHRQRPLGSSTQGLRPPLPLCGVAPLQCCLPAPPLEPYLRPRGQSATHRWGRQLQCSPREGPASTPMSSAAPQ APA
GeneID:
149473
Add. information Mouse polyclonal antibody raised against a full-length human CCDC24 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC24 (1 products)

Catalog No. Species Pres. Purity   Source  

Coiled-coil domain containing 24 (CCDC24)

Coiled-coil domain containing 24 (CCDC24) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for CCDC24 (1 products)

Catalog No. Species Pres. Purity   Source  

CCDC24 overexpression lysate

CCDC24 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn