discontinued

NBP1-91134 CCDC61 antibody

See related secondary antibodies

Search for all "CCDC61"

Quick Overview

Rabbit anti Human CCDC61

Product Description for CCDC61

Rabbit anti Human CCDC61.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CCDC61

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B8HED9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KTGNFKQFNIFCHMLESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGSLAPRSAQLNSKRYLILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLK
GeneID:
7294400
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 7294400

Accessory Products

  • LinkedIn