TA335436 CCDC70 antibody

Rabbit Polyclonal Anti-CCDC70 Antibody

See related secondary antibodies

Search for all "CCDC70"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CCDC70

Product Description for CCDC70

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CCDC70.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC70

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Coiled-coil domain-containing protein 70
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NSX1
Immunogen:
The immunogen for Anti-CCDC70 Antibody: synthetic peptide directed towards the middle region of human CCDC70. Synthetic peptide located within the following region: TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT.
GeneID:
83446
Application WB
Background The specific function of CCDC70 is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CCDC70 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC70 Lysate

Western Blot: CCDC70 Lysate [NBL1-08816] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCDC70
  Novus Biologicals Inc.

CCDC70 overexpression lysate

CCDC70 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn