H00064925-B01P CCDC71 antibody

See related secondary antibodies

Search for all "CCDC71"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CCDC71

H00064925-B01P

Product Description for CCDC71

Mouse anti Human CCDC71.
Product is tested for Western blot / Immunoblot.

Properties for CCDC71

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ12800, FLJ13629
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IV32
Immunogen:
CCDC71 (NP_075054.2, 1 a.a. ~ 467 a.a) full-length human protein.
AA Sequence:
MSVVVQHVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSC TANPPSQTKLQARAPNPTATSPPASAPRTAMRLPAGRATLLPMPLSGRLAKASTPALAKHATTNLLLSSLKQSSAS HARGAAVGFPTHLYPGVYPAMRLSVVLEALVPLKTPMPCLGAKHKAQSLQLSLADSPLKLRKSSGKGPGNPRPKAP RKTTSKGPKCLTRKGPGAGPRRGSGHQSKTNRATGSPSVRRMKGGSALGTKTAQAKVARTLAKAARAQAKVARTQA KAAKARAKAKAALVKAKAKAKAAQVKAKAKVMAARAKAKAKAKAVRAKAKVARTQPRGRGRPKGSAKARTTRKGQK NRPETVGQKRKRAEEAKDLPPKKRTRLGPRSPKAWLGPGTAKLLKFRAIKVDRRSSDDEVRQRAQRILRVNLSPVI RLQPLLPYSAV
GeneID:
64925
Add. information Mouse polyclonal antibody raised against a full-length human CCDC71 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for CCDC71 (1 products)

Catalog No. Species Pres. Purity   Source  

CCDC71 overexpression lysate

CCDC71 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn