H00006352-B02 CCL5 antibody

See related secondary antibodies

Search for all "CCL5"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CCL5

H00006352-B02

Product Description for CCL5

Mouse anti Human CCL5.
Product is tested for Western blot / Immunoblot.

Properties for CCL5

Product Category Primary Antibodies
Quantity 50 µl
Synonyms D17S136E, MGC17164, RANTES, SCYA5, SISd, TCP228
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D0EI67
Immunogen:
CCL5 (AAH08600, 1 a.a. ~ 91 a.a) full-length human protein.
AA Sequence:
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANP EKKWVREYINSLEMS
GeneID:
6352
Add. information Mouse polyclonal antibody raised against a full-length human CCL5 protein.
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive.
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for CCL5 (2 products)

Catalog No. Species Pres. Purity   Source  

RANTES

RANTES E. coli
20 µg / €410.00
  GeneTex Inc.

RANTES

RANTES
20 µg / €330.00
  GeneTex Inc.
  • LinkedIn