discontinued

H00009973-A01 CCS / SOD4 antibody

See related secondary antibodies

Search for all "CCS / SOD4"

Quick Overview

Mouse anti Human CCS / SOD4

Product Description for CCS / SOD4

Mouse anti Human CCS / SOD4.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for CCS / SOD4

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms SOD-4, Superoxide Dismutase Copper Chaperone
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O14618
Immunogen:
CCS (NP_005116, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
AA Sequence:
ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLT IWEERGRPIAGKGRKESAQPPAHL*
GeneID:
9973
Remarks:
Gene Accession: NM_005125
Add. information Mouse polyclonal antibody raised against a partial recombinant CCS.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Ti
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9973

Accessory Products

Proteins and/or Positive Controls

Proteins for CCS / SOD4 (8 products)

Catalog No. Species Pres. Purity   Source  

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

Positive controls for CCS / SOD4 (2 products)

Catalog No. Species Pres. Purity   Source  

CCS 293T Cell Transient Overexpression Lysate(Denatured)

CCS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCS overexpression lysate

CCS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn