discontinued

H00009973-B01P CCS / SOD4 antibody

See related secondary antibodies

Search for all "CCS / SOD4"

Quick Overview

Mouse anti Human CCS / SOD4

Product Description for CCS / SOD4

Mouse anti Human CCS / SOD4.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CCS / SOD4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms SOD-4, Superoxide Dismutase Copper Chaperone
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O14618
Immunogen:
CCS (NP_005116.1, 1 a.a. ~ 274 a.a) full-length human protein.
AA Sequence:
MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLK GMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDG ASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACG IIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
GeneID:
9973
Remarks:
Gene Accession: NM_005125.1
Add. information Mouse polyclonal antibody raised against a full-length human CCS protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9973

Accessory Products

Proteins and/or Positive Controls

Proteins for CCS / SOD4 (8 products)

Catalog No. Species Pres. Purity   Source  

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €750.00
  OriGene Technologies GmbH

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

Positive controls for CCS / SOD4 (2 products)

Catalog No. Species Pres. Purity   Source  

CCS 293T Cell Transient Overexpression Lysate(Denatured)

CCS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCS overexpression lysate

CCS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn