TA335688 CCT4 / TCP1 delta antibody

Rabbit Polyclonal Anti-CCT4 Antibody

See related secondary antibodies

Search for all "CCT4 / TCP1 delta"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast CCT4 / TCP1 delta

TA335688

More Views

  • TA335688
  • TA335688
  • TA335688
  • TA335688
  • TA335688

Product Description for CCT4 / TCP1 delta

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast CCT4 / TCP1 delta.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CCT4 / TCP1 delta

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CCT delta, CCTD, SRB, Stimulator of TAR RNA-binding, T-complex protein 1 subunit delta
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt, Ye
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50991
Immunogen:
The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN.
GeneID:
10575
Application IHC
WB
Background The CCT (chaperonin containing TCP-1) complex functions as a molecular chaperone in the eukaryotic cytosol. CCT4 interacts with human cyclin E which has been implicated in positive control of the G1/S phase transition.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCT4 / TCP1 delta (4 products)

Catalog No. Species Pres. Purity   Source  

CCT4 / TCP1 delta

CCT4 / TCP1 delta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

CCT4 / TCP1 delta (N-term HIS tag)

CCT4 / TCP1 delta Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

CCT4 / TCP1 delta

CCT4 / TCP1 delta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCT4 / TCP1 delta

CCT4 / TCP1 delta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CCT4 / TCP1 delta (2 products)

Catalog No. Species Pres. Purity   Source  

CCT4 overexpression lysate

CCT4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

TCP1-delta Lysate

Western Blot: TCP1-delta Lysate [NBL1-08901] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCT4
  Novus Biologicals Inc.
  • LinkedIn