NBP1-56608 CCT8 antibody

See related secondary antibodies

Search for all "CCT8"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat CCT8

Product Description for CCT8

Rabbit anti Canine, Human, Mouse, Rat CCT8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CCT8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Cctq, D21S246, KIAA0002
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK.
Background As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100172606

Accessory Products

  • LinkedIn