discontinued

NBP1-56608 CCT8 antibody

See related secondary antibodies

Search for all "CCT8"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat CCT8

Product Description for CCT8

Rabbit anti Canine, Human, Mouse, Rat CCT8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CCT8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Cctq, D21S246, KIAA0002
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RAP1
Immunogen:
Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK.
GeneID:
100172606
Background As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 100172606

Accessory Products

  • LinkedIn