discontinued

H00005818-A01 CD111 / Nectin 1 antibody

See related secondary antibodies

Search for all "CD111 / Nectin 1"

Quick Overview

Mouse anti Human CD111 / Nectin 1

Product Description for CD111 / Nectin 1

Mouse anti Human CD111 / Nectin 1.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for CD111 / Nectin 1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms HVEC, Herpes virus entry mediator C, Herpesvirus Ig-like receptor, Nectin-1, PRR1, PVRL1, Poliovirus receptor-related protein 1
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15223
Immunogen:
PVRL1 (NP_002846, 33 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
AA Sequence:
VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGT IRLSRLELEDEGVYICEFATFPTGNRESQLNLTV*
GeneID:
5818
Remarks:
Gene Accession: NM_002855
Add. information Mouse polyclonal antibody raised against a partial recombinant PVRL1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5818

Accessory Products

Proteins and/or Positive Controls

Proteins for CD111 / Nectin 1 (9 products)

Catalog No. Species Pres. Purity   Source  

CD111 / Nectin 1 (transcript variant 1)

CD111 / Nectin 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

CD111 / Nectin 1 (transcript variant 1)

CD111 / Nectin 1 E. coli > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

CD111 / Nectin 1

CD111 / Nectin 1 Human
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human > 90 % Sf9-Baculovirus
  Virusys Corporation

Positive controls for CD111 / Nectin 1 (5 products)

Catalog No. Species Pres. Purity   Source  

PVRL1 293T Cell Transient Overexpression Lysate(Denatured)

PVRL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PVRL1 Lysate

Western Blot: PVRL1 Lysate [NBL1-15005] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PVRL1
  Novus Biologicals Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn