discontinued

H00057292-D01P CD158F / KIR2DL5A antibody

See related secondary antibodies

Search for all "CD158F / KIR2DL5A"

Quick Overview

Rabbit anti Human CD158F / KIR2DL5A

Product Description for CD158F / KIR2DL5A

Rabbit anti Human CD158F / KIR2DL5A.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CD158F / KIR2DL5A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CD158F1, KIR2DL5, Killer cell immunoglobulin-like receptor 2DL5A
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N109
Immunogen:
KIR2DL5A (AAI60063.1, 1 a.a. ~ 375 a.a) full-length human protein.
AA Sequence:
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIF WKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDM YHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTE PSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHC VFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
GeneID:
57292
Remarks:
Gene Accession: BC160063.1
Add. information Rabbit polyclonal antibody raised against a full-length human KIR2DL5A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 57292

Accessory Products

Proteins and/or Positive Controls

Proteins for CD158F / KIR2DL5A (1 products)

Catalog No. Species Pres. Purity   Source  

CD158F / KIR2DL5A

CD158F / KIR2DL5A Human
  Abnova Taiwan Corp.

Positive controls for CD158F / KIR2DL5A (1 products)

Catalog No. Species Pres. Purity   Source  

KIR2DL5A overexpression lysate

KIR2DL5A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn