TA338022 CD158F / KIR2DL5A antibody

Rabbit Polyclonal Anti-KIR2DL5A Antibody

See related secondary antibodies

Search for all "CD158F / KIR2DL5A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD158F / KIR2DL5A


More Views

  • TA338022
  • TA338022

Product Description for CD158F / KIR2DL5A

Rabbit anti Human CD158F / KIR2DL5A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD158F / KIR2DL5A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CD158F1, KIR2DL5, Killer cell immunoglobulin-like receptor 2DL5A
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KIR2DL5A antibody is: synthetic peptide directed towards the C-terminal region of Human KIR2DL5A. Synthetic peptide located within the following region: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA.
Application WB
Background Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by tural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory sigls upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kise binding protein to transduce activating sigls. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for CD158F / KIR2DL5A (1 products)

Catalog No. Species Pres. Purity   Source  


CD158F / KIR2DL5A Human
  Abnova Taiwan Corp.

Positive controls for CD158F / KIR2DL5A (1 products)

Catalog No. Species Pres. Purity   Source  

KIR2DL5A overexpression lysate

KIR2DL5A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn