discontinued

H00000356-D01 CD178 / Fas Ligand antibody

See related secondary antibodies

Search for all "CD178 / Fas Ligand"

Quick Overview

Rabbit anti Human CD178 / Fas Ligand

Product Description for CD178 / Fas Ligand

Rabbit anti Human CD178 / Fas Ligand.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for CD178 / Fas Ligand

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms APT1LG1, APTL, Apoptosis antigen ligand, CD95L protein, FASL, FASLG, Fas antigen ligand, TNFSF6, Tumor necrosis factor ligand superfamily member 6
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P48023
Immunogen:
FASLG (AAH17502.1, 1 a.a. ~ 281 a.a) full-length human protein.
AA Sequence:
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGN HSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGK SNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGK MMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
GeneID:
356
Remarks:
Gene Accession: NM_000639
Add. information Rabbit polyclonal antibody raised against a full-length human FASLG protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 356

Accessory Products

Proteins and/or Positive Controls

Proteins for CD178 / Fas Ligand (18 products)

Catalog No. Species Pres. Purity   Source  

CD178 / Fas Ligand

CD178 / Fas Ligand Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
CHO cells
10 µg / €239.00
  OriGene Technologies, Inc.

CD178 / Fas Ligand

CD178 / Fas Ligand Human > 90 %
Preparation: .
Purity Detail: >90%, as determined by Coomassie stained SDS-PAGE.
CHO cells
10 µg / €147.00
  OriGene Technologies, Inc.

CD178 / Fas Ligand (N-term, His-tagged)

CD178 / Fas Ligand Human > 95 % pure by SDS-PAGE gel and HPLC analyses CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (N-term, His-tagged)

CD178 / Fas Ligand Human > 95 % pure by SDS-PAGE gel and HPLC analyses CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (His-tag)

CD178 / Fas Ligand Human Purified > 95 % by SDS-PAGE & HPLC analysis CHO cells
10 µg / €330.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (130-281, His-tag)

CD178 / Fas Ligand Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (130-281, His-tag)

CD178 / Fas Ligand Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (Extracell. Dom.)

CD178 / Fas Ligand Human > 98 % CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (Extracell. Dom.)

CD178 / Fas Ligand Human > 98 % CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand

CD178 / Fas Ligand Human
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human Purified > 98 % CHO cells
  Alpha Diagnostic Intl. Inc.

CD178 / Fas Ligand

CD178 / Fas Ligand Human Purified > 98 % CHO cells
  Alpha Diagnostic Intl. Inc.

CD178 / Fas Ligand (103-281)

CD178 / Fas Ligand Human HEK293 cells
  Kamiya Biomedical Company

Positive controls for CD178 / Fas Ligand (2 products)

Catalog No. Species Pres. Purity   Source  

CD178 / FAS Ligand Lysate(Denatured)

CD178 / FAS Ligand Lysate(Denatured)
  Abnova Taiwan Corp.

Fas Ligand Lysate

Western Blot: Fas Ligand Lysate [NBL1-10600] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FASLG
  Novus Biologicals Inc.
  • LinkedIn