TA330343 CD178 / Fas Ligand antibody

Rabbit Polyclonal Anti-FASLG Antibody

See related secondary antibodies

Search for all "CD178 / Fas Ligand"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD178 / Fas Ligand

Product Description for CD178 / Fas Ligand

Rabbit anti Human CD178 / Fas Ligand.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD178 / Fas Ligand

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms APT1LG1, APTL, Apoptosis antigen ligand, CD95L protein, FASL, FASLG, Fas antigen ligand, TNFSF6, Tumor necrosis factor ligand superfamily member 6
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48023
Immunogen:
The immunogen for anti-FASLG antibody: synthetic peptide directed towards the middle region of human FASLG. Synthetic peptide located within the following region: MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVL.
GeneID:
356
Application WB
Background TNFSF6 is a cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic sigl into cells. May be involved in cytotoxic T cell mediated apoptosis and in T cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD178 / Fas Ligand (18 products)

Catalog No. Species Pres. Purity   Source  

CD178 / Fas Ligand

CD178 / Fas Ligand Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
CHO cells
10 µg / €239.00
  OriGene Technologies, Inc.

CD178 / Fas Ligand

CD178 / Fas Ligand Human > 90 %
Preparation: .
Purity Detail: >90%, as determined by Coomassie stained SDS-PAGE.
CHO cells
10 µg / €147.00
  OriGene Technologies, Inc.

CD178 / Fas Ligand (N-term, His-tagged)

CD178 / Fas Ligand Human > 95 % pure by SDS-PAGE gel and HPLC analyses CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (N-term, His-tagged)

CD178 / Fas Ligand Human > 95 % pure by SDS-PAGE gel and HPLC analyses CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (His-tag)

CD178 / Fas Ligand Human Purified > 95 % by SDS-PAGE & HPLC analysis CHO cells
10 µg / €330.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (130-281, His-tag)

CD178 / Fas Ligand Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (130-281, His-tag)

CD178 / Fas Ligand Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

CD178 / Fas Ligand (Extracell. Dom.)

CD178 / Fas Ligand Human > 98 % CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand (Extracell. Dom.)

CD178 / Fas Ligand Human > 98 % CHO cells
  OriGene Technologies GmbH

CD178 / Fas Ligand

CD178 / Fas Ligand Human
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human
  Abnova Taiwan Corp.

CD178 / Fas Ligand

CD178 / Fas Ligand Human Purified > 98 % CHO cells
  Alpha Diagnostic Intl. Inc.

CD178 / Fas Ligand

CD178 / Fas Ligand Human Purified > 98 % CHO cells
  Alpha Diagnostic Intl. Inc.

CD178 / Fas Ligand (103-281)

CD178 / Fas Ligand Human HEK293 cells
  Kamiya Biomedical Company

Positive controls for CD178 / Fas Ligand (2 products)

Catalog No. Species Pres. Purity   Source  

CD178 / FAS Ligand Lysate(Denatured)

CD178 / FAS Ligand Lysate(Denatured)
  Abnova Taiwan Corp.

Fas Ligand Lysate

Western Blot: Fas Ligand Lysate [NBL1-10600] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FASLG
  Novus Biologicals Inc.
  • LinkedIn