NBP1-68990 CD200R antibody

See related secondary antibodies

Search for all "CD200R"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD200R


Product Description for CD200R

Rabbit anti Human CD200R.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CD200R

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CD200R, HCRTR2, MOX2R, OX2R
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CD200R1 (CD200 receptor 1) The peptide sequence was selected from the N terminal of CD200R1. Peptide sequence NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL.
Background This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn