
NBP1-68990 CD200R antibody

See related secondary antibodies

Search for all "CD200R"

Quick Overview

Rabbit anti Human CD200R


Product Description for CD200R

Rabbit anti Human CD200R.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CD200R

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CD200R, HCRTR2, MOX2R, OX2R
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CD200R1 (CD200 receptor 1) The peptide sequence was selected from the N terminal of CD200R1. Peptide sequence NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL.
Background This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn