NBP1-90020 CD206 / MRC1 antibody

See related secondary antibodies

Search for all "CD206 / MRC1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD206 / MRC1

NBP1-90020

More Views

  • NBP1-90020

Product Description for CD206 / MRC1

Rabbit anti Human CD206 / MRC1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CD206 / MRC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-type lectin domain family 13 member D, C-type lectin domain family 13 member D-like, CLEC13D, CLEC13DL, MRC1L1, Macrophage mannose receptor 1, Macrophage mannose receptor 1-like protein 1
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VSK2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
GeneID:
4360
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 414308

Accessory Products

  • LinkedIn