discontinued

H00008519-D01P CD225 / IFITM1 antibody

See related secondary antibodies

Search for all "CD225 / IFITM1"

Quick Overview

Rabbit anti Human CD225 / IFITM1

Product Description for CD225 / IFITM1

Rabbit anti Human CD225 / IFITM1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CD225 / IFITM1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms IFI17, Interferon-induced protein 17, Interferon-induced transmembrane protein 1, Interferon-inducible protein 9-27, Leu-13 antigen
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P13164
Immunogen:
IFITM1 (AAH00897.1, 1 a.a. ~ 125 a.a) full-length human protein.
AA Sequence:
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQ AYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
GeneID:
8519
Remarks:
Gene Accession: BC000897
Add. information Rabbit polyclonal antibody raised against a full-length human IFITM1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8519

Accessory Products

Proteins and/or Positive Controls

Proteins for CD225 / IFITM1 (7 products)

Catalog No. Species Pres. Purity   Source  

CD225 / IFITM1

CD225 / IFITM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

CD225 / IFITM1

CD225 / IFITM1 Human
  Abnova Taiwan Corp.

CD225 / IFITM1

CD225 / IFITM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD225 / IFITM1

CD225 / IFITM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD225 / IFITM1

CD225 / IFITM1 Human Purified
  Abnova Taiwan Corp.

CD225 / IFITM1

CD225 / IFITM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD225 / IFITM1

CD225 / IFITM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CD225 / IFITM1 (1 products)

Catalog No. Species Pres. Purity   Source  

IFITM1 Lysate

Western Blot: IFITM1 Lysate [NBL1-11839] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IFITM1
  Novus Biologicals Inc.
  • LinkedIn