TA342883 CD239 / BCAM antibody

Rabbit Polyclonal Anti-BCAM Antibody

See related secondary antibodies

Search for all "CD239 / BCAM"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit CD239 / BCAM

Product Description for CD239 / BCAM

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit CD239 / BCAM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD239 / BCAM

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Auberger B, Auberger B antigen, B-CAM, B-CAM cell surface glycoprotein, F8/G253, LU, Lutheran blood group glycoprotein, MSK19
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL.
Application WB
Background Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-termil cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 641% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for CD239 / BCAM (3 products)

Catalog No. Species Pres. Purity   Source  

CD239 / BCAM (transcript variant 1)

CD239 / BCAM Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CD239 / BCAM

CD239 / BCAM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD239 / BCAM

CD239 / BCAM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD239 / BCAM (2 products)

Catalog No. Species Pres. Purity   Source  

BCAM overexpression lysate

BCAM overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CD239 Lysate

Western Blot: CD239 Lysate [NBL1-07931] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BCAM Protein
  Novus Biologicals Inc.
  • LinkedIn