discontinued

H00010333-M06 CD286 / TLR6 antibody

See related secondary antibodies

Search for all "CD286 / TLR6"

Quick Overview

Mouse anti Human CD286 / TLR6 1A5

Product Description for CD286 / TLR6

Mouse anti Human CD286 / TLR6 1A5.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for CD286 / TLR6

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Toll-like receptor 6
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 1A5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2C9
Immunogen:
TLR6 (NP_006059, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPK PVEYLNIYNLTIIESIREEDFTYS*
GeneID:
10333
Remarks:
Gene Accession: NM_006068
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant TLR6.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10333

Accessory Products

Proteins and/or Positive Controls

Proteins for CD286 / TLR6 (3 products)

Catalog No. Species Pres. Purity   Source  

CD286 / TLR6

CD286 / TLR6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD286 / TLR6

CD286 / TLR6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD286 / TLR6

CD286 / TLR6 Human
  Abnova Taiwan Corp.

Positive controls for CD286 / TLR6 (1 products)

Catalog No. Species Pres. Purity   Source  

TLR6 Lysate

Western Blot: TLR6 Lysate [NBL1-16955] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TLR6.
  Novus Biologicals Inc.
  • LinkedIn