discontinued

H00000962-B01P CD48 antibody

See related secondary antibodies

Search for all "CD48"

Quick Overview

Mouse anti Human CD48

H00000962-B01P

More Views

  • H00000962-B01P

Product Description for CD48

Mouse anti Human CD48.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CD48

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms B-lymphocyte activation marker BLAST-1, BCM1, BCM1 surface antigen, BLAST1, Leukocyte antigen MEM-102, MEM-102, TCT.1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09326
Immunogen:
CD48 (NP_001769.2, 1 a.a. ~ 243 a.a) full-length human protein.
AA Sequence:
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKY FESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKL SCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIAS WLVVTVPTILGLLLT
GeneID:
962
Remarks:
Gene Accession: NM_001778
Add. information Mouse polyclonal antibody raised against a full-length human CD48 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 962

Accessory Products

Proteins and/or Positive Controls

Proteins for CD48 (6 products)

Catalog No. Species Pres. Purity   Source  

CD48

CD48 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €139.00
  OriGene Technologies, Inc.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human Purified
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD48 (3 products)

Catalog No. Species Pres. Purity   Source  

CD48 293T Cell Transient Overexpression Lysate(Denatured)

CD48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CD48 Lysate

Western Blot: CD48 Lysate [NBL1-08955] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CD48
  Novus Biologicals Inc.

CD48 overexpression lysate

CD48 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn