discontinued

H00000962-M01 CD48 antibody

See related secondary antibodies

Search for all "CD48"

Quick Overview

Mouse anti Human CD48 3B8-2C2

H00000962-M01

More Views

  • H00000962-M01

Product Description for CD48

Mouse anti Human CD48 3B8-2C2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for CD48

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms B-lymphocyte activation marker BLAST-1, BCM1, BCM1 surface antigen, BLAST1, Leukocyte antigen MEM-102, MEM-102, TCT.1
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3B8-2C2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09326
Immunogen:
CD48 (AAH30224, 1 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKY FESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASW EAWGTLGEEERKTSGQV*
GeneID:
962
Remarks:
Gene Accession: BC030224
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant CD48.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 962

Accessory Products

Proteins and/or Positive Controls

Proteins for CD48 (6 products)

Catalog No. Species Pres. Purity   Source  

CD48

CD48 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €139.00
  OriGene Technologies, Inc.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human Purified
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD48

CD48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD48 (3 products)

Catalog No. Species Pres. Purity   Source  

CD48 293T Cell Transient Overexpression Lysate(Denatured)

CD48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CD48 Lysate

Western Blot: CD48 Lysate [NBL1-08955] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CD48
  Novus Biologicals Inc.

CD48 overexpression lysate

CD48 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn