discontinued

H00000972-D01P CD74 antibody

See related secondary antibodies

Search for all "CD74"

Quick Overview

Rabbit anti Human CD74

H00000972-D01P

More Views

  • H00000972-D01P

Product Description for CD74

Rabbit anti Human CD74.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CD74

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DHLAG, HLA class II histocompatibility antigen gamma chain, HLA-DR antigens-associated invariant chain, Ia antigen-associated invariant chain, p33
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P04233
Immunogen:
CD74 (NP_001020329.1, 1 a.a. ~ 160 a.a) full-length human protein.
AA Sequence:
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQG RLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNW RTRLLGWV
GeneID:
972
Remarks:
Gene Accession: NM_001025158.1
Add. information Rabbit polyclonal antibody raised against a full-length human CD74 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,PLA-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 972

Accessory Products

Proteins and/or Positive Controls

Proteins for CD74 (9 products)

Catalog No. Species Pres. Purity   Source  

CD74 (transcript variant 1)

CD74 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CD74 (73-232, His-tag)

CD74 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

CD74 (73-232, His-tag)

CD74 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

CD74 (73-232, His-tag)

CD74 Human Purified > 85 % by SDS - PAGE.
0.25 mg / €940.00
  OriGene Technologies GmbH

CD74 (73-232, His-tag)

CD74 Human Purified > 85 % by SDS - PAGE.
50 µg / €300.00
  OriGene Technologies GmbH

CD74

CD74 Human
  Abnova Taiwan Corp.

CD74

CD74 Human in vitro transl.
  Abnova Taiwan Corp.

CD74

CD74 Human in vitro transl.
  Abnova Taiwan Corp.

CD74

CD74 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD74 (5 products)

Catalog No. Species Pres. Purity   Source  

CD74 Lysate

Western Blot: CD74 Lysate [NBL1-08968] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CD74
  Novus Biologicals Inc.

CD74 overexpression lysate

CD74 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CD74 overexpression lysate

CD74 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CD74 overexpression lysate

CD74 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CD74 overexpression lysate

CD74 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn