discontinued

H00000985-M01 CDC2L2 antibody

See related secondary antibodies

Search for all "CDC2L2"

0.1 mg / €370.00

Quick Overview

Mouse anti Human CDC2L2 1A9

H00000985-M01

Product Description for CDC2L2

Mouse anti Human CDC2L2 1A9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDC2L2

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Monoclonal
Clone 1A9
Host Mouse
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
CDC2L2 (NP_277073, 681 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLK ETGFHLTTTNQGASAAGPGFSLKF
Remarks:
Gene Accession: NM_033531
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
State:
Purified

Accessory Products

  • LinkedIn