NBP1-55472 CDCA7L antibody

See related secondary antibodies

Search for all "CDCA7L"

Quick Overview

Rabbit anti Human CDCA7L

Product Description for CDCA7L

Rabbit anti Human CDCA7L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CDCA7L

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp762L0311, JPO2, R1, RAM2
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CDCA7L(cell division cycle associated 7-like) The peptide sequence was selected from the middle region of CDCA7L. Peptide sequence PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED.
Background CDCA7L plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter.CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 55536

Accessory Products

  • LinkedIn