H00389118-B01P CDHR4 antibody

See related secondary antibodies

Search for all "CDHR4"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CDHR4

H00389118-B01P

Product Description for CDHR4

Mouse anti Human CDHR4.
Product is tested for Western blot / Immunoblot.

Properties for CDHR4

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC164982, PRO34300
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6H8M9
Immunogen:
CDHR4 (ADR82858.1, 1 a.a. ~ 199 a.a) full-length human protein.
AA Sequence:
MVLLRLLVFLFAPVVSDLCSLPCFINVSESQGPGTVLQFLSFNCSSYTPTPTLELLNVQPPTTFFNPPSLARWQGT YVGKLTLSSSAQLDALMVNHYKVQLKFTCGNHVMEGSLSVDVQRDLSHIQCAGQFASPGEARGSRQGGGRHGLSRS SLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
GeneID:
389118
Add. information Mouse polyclonal antibody raised against a full-length human CDHR4 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for CDHR4 (1 products)

Catalog No. Species Pres. Purity   Source  

CDHR4 overexpression lysate

CDHR4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn