discontinued

NBP1-70492 CEACAM16 antibody

See related secondary antibodies

Search for all "CEACAM16"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat CEACAM16

Product Description for CEACAM16

Rabbit anti Human, Mouse, Rat CEACAM16.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CEACAM16

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2LPN5
Immunogen:
Synthetic peptides corresponding to CEACAM16(carcinoembryonic antigen-related cell adhesion molecule 16) The peptide sequence was selected from the middle region of CEACAM16. Peptide sequence TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGF
GeneID:
3885510
Background CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3885510

Accessory Products

  • LinkedIn